PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01929.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 580aa    MW: 66580 Da    PI: 7.0668
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01929.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.42.1e-2182182198
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f kvl+ sd+ k+g +vl k++a e+       ++    s++++ +d +gr+W++k++ r++++r+++++GW+eF+k ++L +gD+
  Rsa1.0_01929.1_g00007.1  82 FTKVLSDSDTRKNGGFVLYKRHAIEClplldmsQLT--PSQEIIAKDIHGREWSFKHTLRGTPKRHLFSSGWNEFAKGKELVAGDS 165
                              89****************************965444..5669******************************************** PP

                              EEEEE-SSSEE..EEEEE- CS
                       B3  80 vvFkldgrsefelvvkvfr 98 
                              +vF +   +++e +v++ +
  Rsa1.0_01929.1_g00007.1 166 FVFLR--GENGESRVGISK 182
                              ****3..377777899876 PP

2Auxin_resp78.22.1e-26209287283
               Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               +a++ k++F v+Y+Pr+  s+F v+++k+++ +++k+s+G++f m+fe++  +e+r+ Gtvvgv+d+++ +W++S+Wr+L+
  Rsa1.0_01929.1_g00007.1 209 LNAIRDKCMFVVFYKPRS--SQFLVNFDKFVDRVNNKFSIGSKFSMRFEGKYLNEIRYNGTVVGVRDFST-HWKDSEWRNLE 287
                              68999************6..9**********************************************777.********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.4E-3473196IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-2879188IPR015300DNA-binding pseudobarrel domain
CDDcd100177.89E-1881182No hitNo description
PROSITE profilePS5086312.61982184IPR003340B3 DNA binding domain
SMARTSM010199.9E-1982184IPR003340B3 DNA binding domain
PfamPF023621.4E-1882181IPR003340B3 DNA binding domain
PfamPF065071.1E-23209286IPR010525Auxin response factor
PROSITE profilePS5174516.497421511IPR000270PB1 domain
SuperFamilySSF542771.77E-6424496No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MAGDKIMHVQ PEVLAIDETN NYLNNQLWKL CAGPLFDTPK IGEKVETNTD EIYAEVSLVP  60
DTSDVEIPIP KNKNNIQNIN YFTKVLSDSD TRKNGGFVLY KRHAIECLPL LDMSQLTPSQ  120
EIIAKDIHGR EWSFKHTLRG TPKRHLFSSG WNEFAKGKEL VAGDSFVFLR GENGESRVGI  180
SKAPHQQHNI PTSLISKQSM HHGVVATVLN AIRDKCMFVV FYKPRSSQFL VNFDKFVDRV  240
NNKFSIGSKF SMRFEGKYLN EIRYNGTVVG VRDFSTHWKD SEWRNLEVQW DGAATIPRPD  300
KVSPWEIELL THSSPIFKSD DLKHKRQIEV NEFGQEVGNS DIQSSMSYSF PTMSKPNYNE  360
QMVQAMKETT TTTTTSCRLF GVDLTVPATT KDSIKPIDSY KKIKISKIFE EEEIVNHVQA  420
RSLTKVHMEG VIEKTVDLTI FDGYNQLIDE IERLFDIKGE LHMHNQWKMF FIYDEGDMMI  480
LGDDPWPKFC NMAKEIFICS KEDVKIGIAD NRFSKALETW NRLQVQIPVV QWHHSVFFKG  540
SIPSMDKLRG WGLNVSSDCL LCASHQEKRQ RIFLVAHIPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B9e-902031016355Auxin response factor 1
4ldx_A9e-902031016355Auxin response factor 1
4ldw_B1e-892031016355Auxin response factor 1
4ldw_A1e-892031016355Auxin response factor 1
4ldv_A1e-892031016355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794860.0JN979486.1 Brassica rapa subsp. pekinensis auxin response factor 25 (ARF25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013713379.10.0PREDICTED: auxin response factor 20-like
SwissprotQ9C8N91e-175ARFU_ARATH; Putative auxin response factor 21
TrEMBLA0A078E1G60.0A0A078E1G6_BRANA; Auxin response factor
STRINGBra027944.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7653631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.11e-164auxin response factor 14